PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK44814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 233aa    MW: 26425.2 Da    PI: 8.8897
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK44814.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.92.1e-3385142259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+vers +d ++v++tYeg+Hnh+
  KFK44814.1  85 EDGYRWRKYGQKAVKNSSYPRSYYRCTTQKCNVKKRVERSFQDSSIVITTYEGKHNHP 142
                 8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-3569144IPR003657WRKY domain
SuperFamilySSF1182901.83E-2976144IPR003657WRKY domain
PROSITE profilePS5081131.62879144IPR003657WRKY domain
SMARTSM007741.5E-3884143IPR003657WRKY domain
PfamPF031067.5E-2685142IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MGQMVNYPYL NHNTNSPIAS SSSNEAEPQE IPHDKNVPME DNEGDQHGVG ESSKQPKKQG  60
KGKGEKKEKE PRVAFMTKSD IDHLEDGYRW RKYGQKAVKN SSYPRSYYRC TTQKCNVKKR  120
VERSFQDSSI VITTYEGKHN HPIPSTLRGT VGTEHLLGHH GGSGLLHSFP RHQQAFLMMN  180
HQSPINYQSV GSMSYEQYGH GNSSYNNNNN NQQVVDYGLL QDIVPSMFLK HES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-2774145778Probable WRKY transcription factor 4
1wj2_A1e-2774145778Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415540.11e-112hypothetical protein EUTSA_v10009672mg
SwissprotQ93WV41e-112WRK71_ARATH; Probable WRKY transcription factor 71
TrEMBLA0A087HRR21e-175A0A087HRR2_ARAAL; Uncharacterized protein
STRINGAT1G29860.11e-109(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139111825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.16e-90WRKY DNA-binding protein 71